Primary Antibodies

Jump to Filters
View as table Download
RPL18A (C-term) Rabbit Polyclonal Antibody
AP53710PU-N

USD 580.00

2 Weeks

RPL18A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human RPL18A.
RPL18A Rabbit Polyclonal Antibody
TA334363

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL18A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18A antibody is: synthetic peptide directed towards the C-terminal region of Human RPL18A. Synthetic peptide located within the following region: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF