Primary Antibodies

Jump to Filters
View as table Download
OR8D1 Rabbit Polyclonal Antibody
TA316300

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR8D1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR8D1.
OR8D1 Rabbit Polyclonal Antibody
TA332340

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D1. Synthetic peptide located within the following region: SKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPM
OR8D1 Rabbit Polyclonal Antibody
TA337525

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D1. Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA