Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-OR2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT |
Rabbit Polyclonal Anti-OR2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: VMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRL |
OR2J2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human OR2J2 |
Active filters
Target Symbol
- OR2J2
Conjugates
- Unconjugated
Pathways
- Olfactory transduction