Primary Antibodies

Jump to Filters
View as table Download
OR2C1 Rabbit Polyclonal Antibody
TA314307

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR2C1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2C1.
OR2C1 Rabbit Polyclonal Antibody
TA342706

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA