Primary Antibodies

Jump to Filters
View as table Download
OR11A1 Rabbit Polyclonal Antibody
TA331989

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR11A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR11A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR11A1. Synthetic peptide located within the following region: YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK
OR11A1 Rabbit Polyclonal Antibody
TA360409

USD 539.00

5 Days

OR11A1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR11A1