PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-BB. |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-BB. |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-BB. |
Anti-PDGFB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-115 amino acids of Human platelet-derived growth factor beta polypeptide |
PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1) |
Rabbit Polyclonal PDGF-B Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal PDGF-B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PDGF-B. |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit anti-PDGFB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFB |
Rabbit polyclonal anti-PDGFB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PDGFB. |
Rabbit Polyclonal PDGFB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human PDGFB. |