GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GRK1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of Human G protein-coupled receptor kinase 1 |
Rabbit polyclonal GRK1 (Ab-21) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRK1 around the phosphorylation site of serine 21 (R-G-SP-F-D) |
GRK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GRK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK1 antibody: synthetic peptide directed towards the middle region of human GRK1. Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR |
GRK1 mouse monoclonal antibody,clone OTI1E11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRK1 mouse monoclonal antibody,clone OTI4G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".