Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-ADI1 mouse monoclonal antibody, clone OTI3H6 (formerly 3H6)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ADI1 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ADI1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human ADI1 |
Rabbit Polyclonal Anti-ADI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI |
Rabbit Polyclonal Anti-ADI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK |
Active filters
Target Symbol
- ADI1
Conjugates
- Unconjugated
Pathways
- Cysteine and methionine metabolism