Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI12E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI2C12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFSF10 mouse monoclonal antibody,clone OTI12E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFSF10 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Trail Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
TNFSF10 mouse monoclonal antibody,clone OTI9A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CD253 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse. |
Rabbit Polyclonal Anti-TNFSF10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE |
Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin. |
Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse. |
Active filters
Target Symbol
- TRAIL
Conjugates
- Unconjugated
Pathways
- Apoptosis