Primary Antibodies

Jump to Filters
View as table Download
CSNK2A2 Rabbit Polyclonal Antibody
TA327103

USD 365.00

3 Weeks

Rabbit anti-CSNK2A2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CSNK2A2
CSNK2A2 Rabbit Polyclonal Antibody
TA335860

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
CSNK2A2 Rabbit Polyclonal Antibody
TA335861

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR