Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV |
Germany
Japan
United Kingdom
China