Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 2A6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 2A6.

Rabbit Polyclonal Anti-CYP2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A6 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A6. Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD

Rabbit Polyclonal Anti-CYP2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A6 antibody: synthetic peptide directed towards the C terminal of human CYP2A6. Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH