Primary Antibodies

Jump to Filters
View as table Download
KCNN2 Rabbit Polyclonal Antibody
TA338526

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
KCNN2 Goat Polyclonal Antibody
AP10032PU-N

USD 520.00

5 Days

KCNN2 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the Internal region of the protein sequence according to NP_067627.2; NP_740721.1.
KCNN2 Rabbit Polyclonal Antibody
TA338745

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ