Rabbit Polyclonal antibody to SEC61A1 (Sec61 alpha 1 subunit (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Dog, Pig, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 413 and 476 of SEC61A1 |
Rabbit Polyclonal Anti-SEC61A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEC61A1 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC61A1. Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC |
Goat Polyclonal Antibody against SEC61A1
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KEQSEVGSMGALLF, from the C Terminus of the protein sequence according to NP_037468.1. |
SEC61A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEC61A1 |
Germany
Japan
United Kingdom
China
