Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
IL3RA mouse monoclonal antibody, clone OTI10D1
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IL3RA mouse monoclonal antibody, clone OTI4A10
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IL3RA mouse monoclonal antibody, clone OTI10D4
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IL3RA mouse monoclonal antibody, clone OTI1E12
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- IL3RA
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Apoptosis