Primary Antibodies

Jump to Filters
View as table Download
TAF2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA504588

USD 447.00

In Stock

TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TAF2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF504588

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TAF2 (C-term) Rabbit Polyclonal Antibody
AP54144PU-N

USD 580.00

2 Weeks

TAF2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1159~1188 amino acids from the C-terminal region of human TAF2
TAF2 Rabbit Polyclonal Antibody
TA334029

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH