Primary Antibodies

Jump to Filters
View as table Download
PPM1H (Center) Rabbit Polyclonal Antibody
AP53413PU-N

USD 580.00

2 Weeks

PPM1H (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 235~263 amino acids from the Central region of Human PPM1H
PPM1H Rabbit Polyclonal Antibody
TA331287

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPM1H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK
PPM1H Rabbit Polyclonal Antibody
TA360477

USD 539.00

5 Days

PPM1H Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PPM1H