Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Pro-EGF Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
EGF mouse monoclonal antibody,clone OTI8E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGF mouse monoclonal antibody, clone S-120, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-145, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-177, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-134, Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China