Germany
Japan
United Kingdom
China
IL21 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) E.coli derived recombinant human IL-21. |
Primary Antibodies
View as table Download
IL-21 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor . |
IL21 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) E.coli derived recombinant human IL-21. |
IL21 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein raised in yeast, corresponding to amino acid residues 24-152 of bovine IL-21 protein |
IL21 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein raised in yeast, corresponding to amino acid residues 24-152 of bovine IL-21 protein |
Rabbit Polyclonal Anti-IL21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS |
Rabbit polyclonal anti-IL21 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IL21. |
IL21 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IL21
Clonalities
- Polyclonal