Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-GJB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2. Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
GJB2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of rat Connexin 26 |
Rabbit Polyclonal Anti-GJB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Goat Polyclonal Antibody against GJB2
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence YLLIRYCSGKSKKP, from the C Terminus of the protein sequence according to NP_003995.2. |
Rabbit Polyclonal Anti-Connexin 26 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
GJB2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse GJB2 |
Active filters
Target Symbol
- GJB2
Clonalities
- Polyclonal