Primary Antibodies

Jump to Filters
View as table Download
Complement C4B (C4B) Rabbit Polyclonal Antibody
TA346240

USD 539.00

5 Days

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Complement C4B (C4B) Chicken Polyclonal Antibody
TA316579

USD 535.00

5 Days

Complement C4B Chicken Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Complement C4B antibody was raised against purified human complement C4b.