Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK