Rabbit Polyclonal Anti-GPR15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR15 |
Rabbit Polyclonal Anti-GPR15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR15 |
GPR15 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR15 |
Rabbit polyclonal anti-GPR15 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR15. |
Rabbit Polyclonal GPR15 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPR15 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human GPR15. The sequence differs from those of African green monkey and pig-tailed macaque BOB by one amino acid (2). |
Rabbit Polyclonal Anti-GPR15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15. Synthetic peptide located within the following region: FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS |