Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXC1 |
FOXC1 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Dynthetic peptide from an internal region of Human FOXC1 (NP_001444.2). |
Rabbit polyclonal anti-FOXC1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXC1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Foxc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP |
FOXC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FOXC1
Reactivities
- Mouse
Clonalities
- Polyclonal