Rabbit Polyclonal Anti-SSTR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV |
Rabbit Polyclonal Anti-SSTR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV |
SSTR4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China