Primary Antibodies

Jump to Filters
View as table Download
MINPP1 (N-term) Rabbit Polyclonal Antibody
AP52700PU-N

USD 580.00

2 Weeks

MINPP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 35-63 amino acids from the N-terminal region of Human MINPP1
MINPP1 Rabbit Polyclonal Antibody
TA308980

USD 625.00

5 Days

Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1)
MINPP1 Rabbit Polyclonal Antibody
TA312927

USD 380.00

In Stock

Rabbit polyclonal anti-MINPP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MINPP1.
MINPP1 Rabbit Polyclonal Antibody
TA331213

USD 539.00

5 Days

Rabbit Polyclonal Anti-MINPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL