Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
EPN3 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human EPN3 |
Rabbit Polyclonal Anti-EPN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EPN3 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPN3. Synthetic peptide located within the following region: ESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGIL |
EPN3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EPN3 |
Active filters
Target Symbol
- EPN3
Clonalities
- Polyclonal
Pathways
- Endocytosis