Primary Antibodies

Jump to Filters
View as table Download
HSPA6 Rabbit Polyclonal Antibody
TA308406

USD 625.00

5 Days

Rabbit Polyclonal antibody to HSPA6 (heat shock 70kDa protein 6 (HSP70B'))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 377 and 628 of HSPA6 (Uniprot ID#P17066)
HSPA6 Rabbit Polyclonal Antibody
TA335045

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV