Primary Antibodies

View as table Download

SEMA4B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen SEMA4B antibody was raised against synthetic 19 amino acid peptide from internal region of human SEMA4B. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (89%).

Rabbit Polyclonal Anti-SEMA4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA4B antibody: synthetic peptide directed towards the N terminal of human SEMA4B. Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS