Primary Antibodies

View as table Download

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

SDF1 (CXCL12) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human SDF-1.

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

Rabbit Polyclonal Anti-SDF 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta

Rabbit Polyclonal Anti-CXCL12 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-beta.

SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-beta.