Primary Antibodies

Jump to Filters
View as table Download
SOS1 Rabbit Polyclonal Antibody
TA343296

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOS1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE
SOS1 Rabbit Polyclonal Antibody
TA381884

USD 365.00

3 Weeks

SOS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1034-1333 of human SOS1 (NP_005624.2).
Modifications Unmodified