Primary Antibodies

Jump to Filters
View as table Download
RPL32 Rabbit Polyclonal Antibody
TA381057

USD 365.00

3 Weeks

RPL32 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RPL32 (NP_000985.1).
Modifications Unmodified
Rpl32 Rabbit Polyclonal Antibody
TA345693

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-Rpl32 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rpl32 antibody is: synthetic peptide directed towards the middle region of Rpl32. Synthetic peptide located within the following region: GSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKA