Primary Antibodies

View as table Download

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA.

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA.

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit Polyclonal Anti-MAVS Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH

Interferon beta (IFNB1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A 17 amino acid peptide located near the centre of human Interferon beta.

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.

Rabbit Polyclonal Anti-IFNE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Rabbit anti-MAVS Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAVS