Primary Antibodies

Jump to Filters
View as table Download
CHST2 Rabbit Polyclonal Antibody
TA339404

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST2 antibody: synthetic peptide directed towards the middle region of human CHST2. Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
CHST2 Rabbit Polyclonal Antibody
TA314907

USD 380.00

In Stock

Rabbit polyclonal anti-CHST2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST2.