Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal RELA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
RELA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal NGFI-B alpha/Nur77/NR4A1 Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a synthetic peptide corresponding to aa 251-266 of human Nak1 (NP_775180). |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- NF-KB P65 (52)
- P53 (52)
- C-JUN (26)
- C-MYC (24)
- NFKB1 (22)
- ATF2 (18)
- C FOS (16)
- IKK BETA (16)
- IKK GAMMA (16)
- NFKB P100 / P52 (14)
- ATF 4 (13)
- EVI1 (12)
- ELK1 (11)
- DDIT3 (10)
- JUND (10)
- MEF2C (10)
- NFATC4 (10)
- NUR77 (10)
- REL B (10)
- TNFRSF1A (10)
- MSK1 (9)
- SERUM RESPONSE FACTOR (9)
- P38 (8)
- TGF BETA 1 (8)
- TNF ALPHA (8)
- MEK3 (7)
- NFAT1 (6)
- MAP3K13 (4)
- MAX (4)
- NLK (4)
- PPP3CB (4)
- DAXX (3)
- ELK4 (3)
- MSK2 / RSK-B (3)
- FGF10 (2)
- PP5 (1)