Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to Unc18-2 (syntaxin binding protein 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Dog, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 101 and 371 of STXBP2 (Uniprot ID#Q15833) |
STXBP2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 439-469 amino acids from the C-terminal region of human STXBP2 |
STXBP2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD |
STXBP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human STXBP2 |
Active filters
Target Symbol
- STXBP2
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency