Goat Anti-AGTPBP1 / NNA1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Rabbit Polyclonal Anti-AGTPBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AGTPBP1 Antibody: synthetic peptide directed towards the N terminal of human AGTPBP1. Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI |
Germany
Japan
United Kingdom
China