Primary Antibodies

View as table Download

Rabbit polyclonal anti-MMP-16 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-16 antibody.

Rabbit Polyclonal Anti-MMP16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MMP16

MMP16 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the C-terminal of human MMP16

Rabbit Polyclonal Anti-MMP16 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP16 Antibody: A synthesized peptide derived from human MMP16

Rabbit Polyclonal Anti-MMP16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP16 antibody: synthetic peptide directed towards the N terminal of human MMP16. Synthetic peptide located within the following region: ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Rabbit anti MMP-16 / MT3-MMP Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated