Primary Antibodies

Jump to Filters
View as table Download
TAF2 (C-term) Rabbit Polyclonal Antibody
AP54144PU-N

USD 580.00

2 Weeks

TAF2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1159~1188 amino acids from the C-terminal region of human TAF2
TAF2 Rabbit Polyclonal Antibody
TA334029

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH