Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SIAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA |
Rabbit Polyclonal Anti-SIAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP |
SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against SIAH1
| Applications | IF, WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SRQTATALPTGTSKC, from the N Terminus of the protein sequence according to NP_003022.3; NP_001006611.1. |
SIAH1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human SIAH1. |
Active filters
Target Symbol
- SIAH1
Reactivities
- Human
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- p53 signaling pathway