Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG2

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV