Rabbit Polyclonal antibody to BPGM (2,3-bisphosphoglycerate mutase)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 246 of BPGM (Uniprot ID#P07738) |
Rabbit Polyclonal Anti-BPGM Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BPGM antibody: synthetic peptide directed towards the C terminal of human BPGM. Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK |
Rabbit Polyclonal Anti-BPGM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BPGM antibody: synthetic peptide directed towards the middle region of human BPGM. Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK |
Germany
Japan
United Kingdom
China
