Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL