Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL

Galactoside 2 alpha L fucosyltransferase 1 (FUT1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FUT1