Primary Antibodies

Jump to Filters
View as table Download
B3GNT4 (Center) Rabbit Polyclonal Antibody
AP50328PU-N

USD 580.00

2 Weeks

B3GNT4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 236-264 amino acids from the Central region of human B3GNT4
B3GNT4 Rabbit Polyclonal Antibody
TA346843

USD 539.00

5 Days

Rabbit Polyclonal Anti-B3GNT4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR