Primary Antibodies

Jump to Filters
View as table Download
AIM2 Rabbit Polyclonal Antibody
TA349676

USD 380.00

In Stock

Rabbit Polyclonal Anti-AIM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AIM2
AIM2 Rabbit Polyclonal Antibody
TA314913

USD 380.00

4 Weeks

Rabbit polyclonal anti-AIM2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIM2.
AIM2 Rabbit Polyclonal Antibody
TA314914

USD 380.00

In Stock

Rabbit polyclonal anti-CSRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSRL1.
AIM2 (N-term) Rabbit Polyclonal Antibody
AP50126PU-N

USD 580.00

2 Weeks

AIM2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 11~40 amino acids from the N-terminal region of human AIM2
AIM2 Goat Polyclonal Antibody
TA326327

USD 520.00

5 Days

Goat Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKQYKSVTKPKPLSQ, from the internal region of the protein sequence according to NP_004824.1.
AIM2 Rabbit Polyclonal Antibody
TA339684

USD 539.00

5 Days

Rabbit Polyclonal Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL