Primary Antibodies

Jump to Filters
View as table Download
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 380.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
B4GALT3 Rabbit Polyclonal Antibody
TA372907

USD 380.00

4 Weeks

B4GALT3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human B4GALT3
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336172

USD 539.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336173

USD 539.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336174

USD 539.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR
B4GALT3 Rabbit Polyclonal Antibody
TA338207

USD 539.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the N terminal of human B4GALT3. Synthetic peptide located within the following region: PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
B4GALT3 Rabbit Polyclonal Antibody
TA338208

USD 539.00

5 Days

Rabbit Polyclonal Anti-B4GALT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the middle region of human B4GALT3. Synthetic peptide located within the following region: MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
B4GALT3 Rabbit Polyclonal Antibody
TA373901

USD 365.00

3 Weeks

B4GALT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human B4GALT3 (NP_003770.1).
Modifications Unmodified