Primary Antibodies

Jump to Filters
View as table Download
CDK6 Rabbit Polyclonal Antibody
TA323938

USD 380.00

In Stock

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6
CDK6 Rabbit Polyclonal Antibody
TA323939

USD 380.00

4 Weeks

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6
CDK6 Rabbit Polyclonal Antibody
TA333180

USD 450.00

3 Weeks

Phospho-CDK6-Y13 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6
Modifications Phospho-specific
CDK6 Rabbit Polyclonal Antibody
TA330350

USD 485.00

5 Days

Rabbit Polyclonal Anti-CDK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK6 antibody: synthetic peptide directed towards the C terminal of human CDK6. Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA