Rabbit Polyclonal Anti-ACVR1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP |
Rabbit polyclonal anti-BCL-XL antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BCL-XL. |
Rabbit polyclonal BCL-XL (Thr115) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL-XL around the phosphorylation site of threonine 115 (H-I-TP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit polyclonal TGF beta Receptor II antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody. |
Rabbit Polyclonal Anti-TGFBR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT |
Rabbit anti Bcl-X Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human BCL-X protein. This sequence is identical in human and mouse. |
Rabbit anti BCL-XL(pS62) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti TGFBR1(Phospho) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit anti TGF-beta 2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Rabbit anti TGF beta Receptor II Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TGFbR2 |
Rabbit anti TGFBR1(Non-Phosphospecific) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti RWSP18 Polyclonal Antibody
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China