Mouse monoclonal Hsp90 Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Insect, Fungi, Plant |
Conjugation | Unconjugated |
Mouse monoclonal Hsp90 Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Insect, Fungi, Plant |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal Anti-TNF-alpha Antibody
Reactivities | Human |
Conjugation | Unconjugated |