Germany
Japan
United Kingdom
China
Mouse monoclonal Hsp90 Antibody
| Applications | IHC |
| Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Insect, Fungi, Plant |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Pathways
- NOD-like receptor signaling pathway
Citations
- Yes